SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00606
         (661 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g33240.1 68417.m04731 phosphatidylinositol-4-phosphate 5-kina...    29   2.7  

>At4g33240.1 68417.m04731 phosphatidylinositol-4-phosphate 5-kinase
            family protein similar to SP|Q9Z1T6 FYVE
            finger-containing phosphoinositide kinase (EC 2.7.1.68)
            (1- phosphatidylinositol-4-phosphate kinase) (PIP5K)
            (PtdIns(4)P-5-kinase) {Mus musculus}; contains Pfam
            profiles PF01504: Phosphatidylinositol-4-phosphate
            5-Kinase, PF01363: FYVE zinc finger, PF00118: TCP-1/cpn60
            chaperonin family
          Length = 1756

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = -1

Query: 403  SCNLMSVLFPEKKNFFNYSNYKDNKYISKEIVLDISTCVLFNGI 272
            S N+ +V  P  K +FNY N +  +  SKE++      VLFN +
Sbjct: 990  SINIYAVTLPPAKLYFNYENQEWLQKESKEVIKKAE--VLFNEV 1031


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,873,985
Number of Sequences: 28952
Number of extensions: 177731
Number of successful extensions: 343
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 342
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 343
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -