BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00603X (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117204-30|CAB55134.2| 269|Caenorhabditis elegans Hypothetical... 36 0.010 AF067623-1|AAC17553.2| 640|Caenorhabditis elegans Hypothetical ... 29 1.6 >AL117204-30|CAB55134.2| 269|Caenorhabditis elegans Hypothetical protein Y116A8C.27 protein. Length = 269 Score = 36.3 bits (80), Expect = 0.010 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +2 Query: 341 PLTRTIAVAWDSQNETMAQATMHLTALCNTARDNP 445 PL IA W SQ+E + M LT L TA+DNP Sbjct: 68 PLALAIAEEWSSQDEFLQLGQMRLTGLAFTAQDNP 102 >AF067623-1|AAC17553.2| 640|Caenorhabditis elegans Hypothetical protein T26C12.1 protein. Length = 640 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +2 Query: 284 FGSSTSKNTKWECINRRNEPLTRTIAVAWDSQNETMAQATMHLTALCNTARDN 442 +G + SK +K +NR + LT+ W+S A L + N N Sbjct: 364 YGRTLSKKSKIVALNRNSSQLTKNEKAFWNSDVSVQADVATSLVQVANALGAN 416 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,153,623 Number of Sequences: 27780 Number of extensions: 234113 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -