BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00601 (396 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1580 - 34576595-34576723,34576905-34576981,34577058-345771... 36 0.009 05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 29 1.8 09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956,606... 28 3.1 11_06_0211 + 21305535-21305895,21306512-21306761,21307543-213076... 27 5.5 08_02_1334 - 26224546-26225337 27 5.5 05_04_0355 - 20577189-20577275,20578001-20578129,20578252-205783... 27 5.5 06_03_0912 + 25896152-25896451,25896528-25897296,25897492-258976... 27 7.2 05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211,229... 27 7.2 04_01_0549 - 7112770-7112774,7112835-7113219,7113306-7113899 27 7.2 04_04_1581 - 34581455-34581466,34581525-34581616,34582584-345826... 26 9.6 >04_04_1580 - 34576595-34576723,34576905-34576981,34577058-34577104, 34577864-34577964,34578114-34578203,34578647-34578763, 34578835-34578992,34579562-34579843,34580367-34580667 Length = 433 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 59 HTFVGTSVNRPLVYHH-DVQYSSKMFRKRVENLHFSLPHVPSIF 187 +T V TS PL +HH +Q S + F+ RV + + + PH+PS F Sbjct: 78 YTMVPTSAMLPLQHHHRQLQISQENFQDRVPSNNVAAPHLPSNF 121 >05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 Length = 454 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 184 YGRYMRQAEMEVFNSLTEHFRAVLHVMVVDQGPIDAGADESVTAF 50 +GR+ A++ VFN+ + L +++ GP DAG + S T + Sbjct: 256 HGRHWEGADVIVFNTYL-WWCTGLQFRILEDGPFDAGGNSSTTTW 299 >09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956, 6066333-6066382,6068917-6069172,6069358-6069503 Length = 1164 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 316 EFLIRARSSCGD*RSYSRFRLGDVRRSSAI 227 ++L R S CGD R F L +RR S + Sbjct: 620 QYLSRGESLCGDPRKLDAFSLSKIRRLSVL 649 >11_06_0211 + 21305535-21305895,21306512-21306761,21307543-21307652, 21308836-21309067,21310233-21310603,21311434-21311507, 21311727-21311880,21312251-21312434,21313066-21313291, 21313704-21314135,21314399-21314456,21314748-21314829, 21315350-21315421,21316594-21316737,21317379-21317457, 21318023-21318105,21318198-21318252,21318488-21318778 Length = 1085 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +1 Query: 232 HCFCEHHPGGIGYNFVNLRMKSERGSKIHYDVYIF 336 +CFC HP + N+VN ++ + ++ +F Sbjct: 1032 YCFCYLHPAKLENNYVNATIRPAHALQFYFMTTLF 1066 >08_02_1334 - 26224546-26225337 Length = 263 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 54 AVTLSSAPASIGPWSTTMTCSTARKCSVREL 146 +VTL+ A++GP T + A C++R+L Sbjct: 9 SVTLADQLAAVGPAGTAAATAAAGSCNLRDL 39 >05_04_0355 - 20577189-20577275,20578001-20578129,20578252-20578371, 20578505-20578741,20578983-20579258,20579375-20579508, 20580006-20581632 Length = 869 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 56 GHTFVGTSVNRPLVYHHDVQYSSKMFRKRVENLHFSLPHVP 178 G VG S NR + +H + S + K+++NL L H+P Sbjct: 829 GRLIVGLS-NREIKKNHGICSSIPFYFKKIDNLIVILDHLP 868 >06_03_0912 + 25896152-25896451,25896528-25897296,25897492-25897658, 25898932-25901013,25901155-25901730,25904503-25905648, 25907056-25908693 Length = 2225 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 77 SVNRPLVYHHDVQYSSKMFRKRVENLHFSLPHVPSI 184 S N PL+Y H SS + K +ENL SL V + Sbjct: 1315 SSNIPLLYKHYDGQSSSLVIKNLENLKGSLGEVQEL 1350 >05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211, 2292397-2292449,2292492-2294478 Length = 868 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 247 VRRSSAIGLVEGQNALNGPPEYGRYMR 167 +RR I L EG+ GP E+ YM+ Sbjct: 646 LRRVKKIILAEGEEQATGPKEFDEYMK 672 >04_01_0549 - 7112770-7112774,7112835-7113219,7113306-7113899 Length = 327 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 253 GDVRRSSAI--GLVEGQNALNGPPEYGRYMRQAEMEVFNSLTE 131 GD R +AI G + + PP+YG Y R E +L E Sbjct: 31 GDPFRVAAISDGFDDDAGCMAAPPDYGEYHRSLEAHGARTLAE 73 >04_04_1581 - 34581455-34581466,34581525-34581616,34582584-34582686, 34583761-34583837,34583913-34583959,34584494-34584594, 34584751-34584840,34585152-34585271,34586171-34586517, 34587013-34587285,34587835-34588165 Length = 530 Score = 26.2 bits (55), Expect = 9.6 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 59 HTFVGTSVNRPLVYHH--DVQYSSKMFRKRVENLHFSLPHVPSIF 187 +T + T P +HH Q S + F+ V + + + PHVPS F Sbjct: 87 YTVLPTPAVLPSHHHHHGQSQISQENFQDWVPSNNVAAPHVPSAF 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,871,874 Number of Sequences: 37544 Number of extensions: 233098 Number of successful extensions: 581 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -