BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00596 (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.75 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 5.3 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 5.3 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 5.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.0 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.6 bits (51), Expect = 0.75 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 330 LELNGHRRRLTWEAMPRSIHEG 395 ++LN HR +++W ++ EG Sbjct: 94 MDLNAHREQMSWPVKKEAVVEG 115 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 14 KLVNSGRTLILVPGHPASGKVVLIK 88 KLV+ G+ L+ GH G+ + IK Sbjct: 1026 KLVSPGQIKSLLTGHGLQGQTIFIK 1050 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 215 LKHDCIITQSTAPGRLMSVAKNTI 144 + HD + +T GRL S+A ++ Sbjct: 170 IPHDVAVNATTGKGRLSSLAVQSL 193 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 215 LKHDCIITQSTAPGRLMSVAKNTI 144 + HD + +T GRL S+A ++ Sbjct: 170 IPHDVAVNATTGKGRLSSLAVQSL 193 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 215 LKHDCIITQSTAPGRLMSVAKNTI 144 + HD + +T GRL S+A ++ Sbjct: 170 IPHDVAVNATTGKGRLSSLAVQSL 193 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.0 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +3 Query: 222 FYVSFRKTRKIDGHQQFFAIVQLIGSRKEAENFAYRLELNGHRR 353 FYV T D +Q I+Q G + + AY L L R Sbjct: 1069 FYVCGDCTMAEDVYQTLKHIIQTHGEMTDKQVEAYMLSLRDENR 1112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,343 Number of Sequences: 438 Number of extensions: 3600 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -