BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00595X (354 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 0.40 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 4.9 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 0.40 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 133 CEFEGEECKKG-NLLGVCTNIRECQSALND 219 CEF+G +C G N CT C D Sbjct: 511 CEFDGNDCSLGINPWANCTASTRCWEVFMD 540 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 20.6 bits (41), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 205 IDIPLYSCRLLINYLFYIL 149 +D L+S RLL+NY+ +L Sbjct: 43 VDRILHSKRLLLNYINCLL 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,315 Number of Sequences: 336 Number of extensions: 1211 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7087595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -