BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00589X (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 2.6 CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence re... 24 3.4 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 3.4 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 3.4 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 3.4 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 3.4 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 3.4 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 3.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.5 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 376 GVELRNQEGLERLSLALHSKIDW 444 GVE+R++ + L + LH + W Sbjct: 731 GVEVRSKRSIRYLGVMLHDHLSW 753 >CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence receptor protein. Length = 284 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 143 RFYRSARDRARSEVRAEDLQTGRSS*QDDAYGWLLSPQTEIQSYTTPPEDAP 298 +F S R R + ++TG +S +D Y W+ P ++ P+ AP Sbjct: 219 QFLGSYGKRKRPTAARKVVETGTASTKDVDYEWI--PSETLKQLQNSPKGAP 268 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 225 LPNMEGVSQINLCLHERDFEVGYGIL 250 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 225 LPNMEGVSQINLCLHERDFEVGYGIL 250 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 225 LPNMEGVSQINLCLHERDFEVGYGIL 250 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 225 LPNMEGVSQINLCLHERDFEVGYGIL 250 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 225 LPNMEGVSQINLCLHERDFEVGYGIL 250 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 385 LRNQEGLERLSLALHSKIDWVGRGYL 462 L N EG+ +++L LH + VG G L Sbjct: 452 LPNMEGVSQINLCLHERDFEVGYGIL 477 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 256 N*DSVLHNAPRGCTFRDNGARVVQRQQ 336 N S+L + CTFR+ + +V RQ+ Sbjct: 992 NATSILRDNGTKCTFREGMSSIVHRQE 1018 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,525 Number of Sequences: 2352 Number of extensions: 11692 Number of successful extensions: 24 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -