BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00588X (595 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0105 + 16693771-16693780,16693833-16693876,16694274-166943... 30 1.6 04_04_1345 + 32792879-32794207 30 1.6 03_05_1071 + 30133696-30133874,30134294-30135200,30135224-301353... 29 2.1 12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325,680... 29 3.7 12_02_0880 + 23965602-23965614,23966150-23966370,23966467-239665... 28 4.9 11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249... 28 4.9 10_07_0130 + 13241085-13241151,13241268-13241339,13242458-132428... 28 4.9 07_03_0154 + 14509979-14512033 28 6.5 05_04_0364 + 20658219-20658416,20658475-20658543 28 6.5 12_01_0015 - 111666-111747,112043-112368,112500-112635,112772-11... 27 8.5 11_04_0332 + 16465360-16465769,16465873-16466272,16466379-164664... 27 8.5 11_01_0015 - 115965-116076,116432-116757,116889-117024,117161-11... 27 8.5 07_01_0117 + 894314-896677 27 8.5 06_03_1069 - 27345207-27345488,27345746-27346078,27346252-273470... 27 8.5 02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 27 8.5 >06_03_0105 + 16693771-16693780,16693833-16693876,16694274-16694348, 16694548-16694784,16694880-16695050,16695137-16695250 Length = 216 Score = 29.9 bits (64), Expect = 1.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 62 NWKCRCRPQTRRGSCWVF 9 N+ CRCRP+ RR W + Sbjct: 5 NYVCRCRPENRRNKGWAY 22 >04_04_1345 + 32792879-32794207 Length = 442 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 361 PPVTKLYK*LLIELASAKTLFVLNSVWV-LKSAGSSYRLHSISPFYQAHAR 212 PPVTK Y LL A + L +W + S G + LHS S + A A+ Sbjct: 174 PPVTKTYNLLLRGWAKTRAWARLRQLWFDMDSRGVAKDLHSYSIYMDALAK 224 >03_05_1071 + 30133696-30133874,30134294-30135200,30135224-30135358, 30135545-30136553,30136699-30136703 Length = 744 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 57 PVTSGTTASKLLPSARGQSLSGALQTSPGSSTRPKAR 167 P +GT+A LLPS G + S ++Q + GS+ A+ Sbjct: 303 PPAAGTSAGPLLPSGGGATGSASVQATGGSAVSVDAK 339 >12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325, 6800407-6800454,6801740-6801836,6801922-6802001, 6802099-6802170,6802335-6802429,6802853-6802934, 6805476-6805853 Length = 478 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 7 ANTQQDPRRVCGRQRHFQLHQGRQRQNCYHQHGANH 114 +N ++ PRR GR R GR R YHQH NH Sbjct: 359 SNDKEGPRRGRGRGRG-----GRGRGRGYHQHNNNH 389 >12_02_0880 + 23965602-23965614,23966150-23966370,23966467-23966503, 23966917-23967100,23967263-23967411,23967515-23967745, 23967850-23968039,23968124-23968433,23968658-23969050 Length = 575 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 324 SINNHLYNLVTGGDYINAVKTVRSLVDNQGSDVCRDVVSQLVSHG 458 ++ +H+YNL G D A + + +Q SD RD+ + HG Sbjct: 268 TMTHHIYNLGAGNDPQVANRILNPQYLSQSSDTFRDLQMTIQRHG 312 >11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911, 27125387-27125656,27126027-27126377,27126480-27126757, 27126887-27128330 Length = 1398 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 15 PTGSPSCLWTTATLPVT-SGTTASKLLPSARGQSLSGALQTSPGSSTRPKA 164 PTG P TT +P + SG + + S +G +S + Q PG + P+A Sbjct: 58 PTGPPPV--TTTPMPTSASGAFSQPSMQSNQGGQVSQSQQERPGQTVYPQA 106 >10_07_0130 + 13241085-13241151,13241268-13241339,13242458-13242862, 13243057-13243112,13244116-13244274,13244379-13244498, 13244591-13245361,13245902-13246078,13246192-13246669, 13247502-13248094 Length = 965 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 178 GYSDNSDDIQNLERELGKKGLYYGAGTNCPQT*GPRRNSARRGS 309 G +D D++ R G++GL + G P+ G +SARR S Sbjct: 834 GANDGGGDVRADMRREGRRGLQHMEGEGVPREPGGGADSARRRS 877 >07_03_0154 + 14509979-14512033 Length = 684 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 48 ATLPVTSGTTASKLLPSARGQSLSGALQTSPGSSTRPKARR 170 ATL ++S A ++P+A ++ +GA+ PGS + K RR Sbjct: 112 ATLYLSSAGAAGVIVPAAAPEASAGAV-AQPGSGSGAKKRR 151 >05_04_0364 + 20658219-20658416,20658475-20658543 Length = 88 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 42 TTATLPVTSGTTASKLLPSARGQSLSGALQTSPGSSTRPKARR 170 +T LPV +++ SAR L L PG S RP + R Sbjct: 12 STCRLPVMKSRHPTRIAQSARPTQLPETLTLQPGRSGRPVSYR 54 >12_01_0015 - 111666-111747,112043-112368,112500-112635,112772-112955, 113067-113135,113703-113829,115810-116051,116125-116279, 116751-116822,116908-116976,117058-117129,117217-117349, 117439-117944,118033-118567,118753-118819 Length = 924 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 103 RADGNSFDAVVPDVTG--SVAVVHRHDGDPVGYL 8 + DGNSF +PD TG + +H D G L Sbjct: 439 KLDGNSFTGQIPDFTGCHDLQYIHLEDNQLTGAL 472 >11_04_0332 + 16465360-16465769,16465873-16466272,16466379-16466423, 16467113-16467139,16467201-16467266,16467889-16467950, 16468049-16468123,16468218-16468383,16468611-16468734, 16469737-16469843,16469992-16470102 Length = 530 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = -1 Query: 529 EVIFDDVLWPSCHSLYANDMAFLMPCETSCETTSRQTSEPWLST 398 +V+ + + PSC +++ D+ + C+T +PW S+ Sbjct: 134 QVLRESLNGPSCEAVHLTDIQSSIECDTFIPPIDLSVFQPWYSS 177 >11_01_0015 - 115965-116076,116432-116757,116889-117024,117161-117344, 117455-117523,118091-118217,120028-120269,120343-120497, 120969-121040,121126-121194,121276-121347,121435-121567, 121661-122166,122255-122789,122943-123018 Length = 937 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 103 RADGNSFDAVVPDVTG--SVAVVHRHDGDPVGYL 8 + DGNSF +PD TG + +H D G L Sbjct: 442 KLDGNSFTGQIPDFTGCHDLQYIHLEDNQLTGAL 475 >07_01_0117 + 894314-896677 Length = 787 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 77 CRP*CNWKCRCRP--QTRRGSCWV 12 C P CNW + +P Q G CWV Sbjct: 499 CSPLCNWVFKLQPSWQLLPGPCWV 522 >06_03_1069 - 27345207-27345488,27345746-27346078,27346252-27347041, 27347153-27347351,27347522-27347667,27347823-27348094, 27348161-27348262,27348351-27348470,27348576-27348729, 27348986-27349114,27349554-27349900 Length = 957 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -3 Query: 527 SNLRRCLVALVPQLVRERHGVLDAMRDELRDDVATDVGALVVDETAH 387 SN+ L +P + H + RD++RD + +D G+ + TAH Sbjct: 899 SNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAH 945 >02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 Length = 489 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 467 VLDAMRDELRDDVATDVGALVVDETAHS 384 V D M + DDV D+ AL V T HS Sbjct: 71 VPDGMPESGNDDVTQDIAALCVSTTRHS 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,699,609 Number of Sequences: 37544 Number of extensions: 275309 Number of successful extensions: 1125 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -