BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00588X (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 0.98 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 2.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 45 TATLPVTSGTTASKLLPSARGQSLSGALQTSPGSSTRPKAR 167 T TLP S T PSA + + + G++T P R Sbjct: 225 TTTLPAASATGTGPATPSAVVATSNATAAMTTGTTTIPTRR 265 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 423 CRDVVSQLVSHGIKNAMSFAYKL 491 C+DV S V+H K+A + A+ + Sbjct: 15 CQDVTSAAVNHQRKSANNLAHSM 37 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -1 Query: 505 WPSCHSLYANDMAFLMPCETSCETTSRQTSE 413 WP C + + AFL T R T++ Sbjct: 285 WPGCEVICEDYQAFLKHLNTEHTLDDRSTAQ 315 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,530 Number of Sequences: 438 Number of extensions: 2776 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -