BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00585 (457 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 26 0.17 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 2.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 6.3 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 26.2 bits (55), Expect = 0.17 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 206 GIYNPIITKMYQGAGGAPEVCRASRAEHP-EPEVPPPGL 319 G+ P + QG+ G P A R HP + PPG+ Sbjct: 332 GLQPPDLAGTSQGSAGLPSAILAMRLSHPLHGNLLPPGV 370 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 278 RAEHPEP-EVPPPGLEALAPPSR 343 R P P + PPPG APPS+ Sbjct: 36 RGSPPNPSQGPPPGGPPGAPPSQ 58 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 54 KSTMEDEKLKEKISDSDKQTILDKCKT 134 + +++ EK+K +S +T+ KC T Sbjct: 331 RCSVKREKIKISVSYPSTETLNTKCNT 357 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,449 Number of Sequences: 438 Number of extensions: 2675 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -