BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00583X (463 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1322.05c |||leukotriene A-4 hydrolase |Schizosaccharomyces p... 27 1.8 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 25 5.6 SPBP16F5.08c |||flavin dependent monooxygenase |Schizosaccharomy... 24 9.8 >SPCC1322.05c |||leukotriene A-4 hydrolase |Schizosaccharomyces pombe|chr 3|||Manual Length = 612 Score = 26.6 bits (56), Expect = 1.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 406 VNAVKFCHGMYEYF 447 VN VKF H +YEYF Sbjct: 418 VNEVKFKHALYEYF 431 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 25.0 bits (52), Expect = 5.6 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 153 SRPNCLKSQMRAPKQ*KFTTVGNTRGRLCS-HLKRCNSNLNDKCN 284 S PN K++ P + +T+G++ GR S ++R SN + N Sbjct: 57 SEPNVFKARPIPPPRQVSSTIGSSTGRKVSGSIQRLASNFKNPSN 101 >SPBP16F5.08c |||flavin dependent monooxygenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 447 Score = 24.2 bits (50), Expect = 9.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 397 RD*VNAVKFCHGMYEYFYVP 456 +D +AV C+G YE Y+P Sbjct: 163 KDIFDAVSICNGHYEVPYIP 182 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,623,737 Number of Sequences: 5004 Number of extensions: 30482 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 174340060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -