BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00568X (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 120 4e-28 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 120 4e-28 At1g76010.1 68414.m08825 expressed protein 30 0.86 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.1 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 29 2.0 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 29 2.0 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 2.6 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 3.5 At2g42200.2 68415.m05223 squamosa promoter-binding protein-like ... 27 4.6 At2g42200.1 68415.m05222 squamosa promoter-binding protein-like ... 27 4.6 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 4.6 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 27 6.1 At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-... 27 8.1 At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-... 27 8.1 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 120 bits (290), Expect = 4e-28 Identities = 54/69 (78%), Positives = 60/69 (86%), Gaps = 1/69 (1%) Frame = +1 Query: 256 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG*RMFAPTKPWRRWHRRVKLR 435 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRG RMFAPTK WRRWHRRV + Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 124 Query: 436 -QRTAVFAA 459 +R A+ +A Sbjct: 125 MKRHAIVSA 133 Score = 58.4 bits (135), Expect = 2e-09 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +2 Query: 83 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 253 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+ Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKK 63 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 120 bits (290), Expect = 4e-28 Identities = 54/69 (78%), Positives = 60/69 (86%), Gaps = 1/69 (1%) Frame = +1 Query: 256 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG*RMFAPTKPWRRWHRRVKLR 435 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRG RMFAPTK WRRWHRRV + Sbjct: 64 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 123 Query: 436 -QRTAVFAA 459 +R A+ +A Sbjct: 124 MKRHAIVSA 132 Score = 60.5 bits (140), Expect = 5e-10 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +2 Query: 74 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 247 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 248 KE 253 K+ Sbjct: 61 KK 62 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 29.9 bits (64), Expect = 0.86 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 375 QG G + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +2 Query: 98 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 28.7 bits (61), Expect = 2.0 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 241 REQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFG 360 R GGG+ S+ +G GR+ R G + RSG G+FG Sbjct: 512 RSGGGGYGGSSGGYGGGRSGGSSNRY-SGDSDRSGFGSFG 550 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 28.7 bits (61), Expect = 2.0 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 247 QGGGHQTSAESWGT---GRAVARIPRVRGGGTHRSGQGAFG 360 +GGG +S G+ G + IP + GGGTHRSG + G Sbjct: 99 RGGGGSSSRGGGGSSSRGGGLRPIP-IYGGGTHRSGHHSSG 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 149 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 149 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 3.5 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 152 GAWLHPAPSHSSLSTPTLKVGLPID--SFRYFSEAIPPKY 39 G W+H SH+ S+ L VG+ + Y+S + P +Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At2g42200.2 68415.m05223 squamosa promoter-binding protein-like 9 (SPL9) identical to squamosa promoter binding protein-like 9 [Arabidopsis thaliana] GI:5931673; contains Pfam profile PF03110: SBP domain Length = 369 Score = 27.5 bits (58), Expect = 4.6 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 244 EQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 348 E GGG S+ S G RVRGGG+ +SGQ Sbjct: 41 EDGGGGSGSSSSGGRSNR-----RVRGGGSGQSGQ 70 >At2g42200.1 68415.m05222 squamosa promoter-binding protein-like 9 (SPL9) identical to squamosa promoter binding protein-like 9 [Arabidopsis thaliana] GI:5931673; contains Pfam profile PF03110: SBP domain Length = 375 Score = 27.5 bits (58), Expect = 4.6 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 244 EQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 348 E GGG S+ S G RVRGGG+ +SGQ Sbjct: 41 EDGGGGSGSSSSGGRSNR-----RVRGGGSGQSGQ 70 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.5 bits (58), Expect = 4.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCR 372 QGGG + G GR R +GGG + G G+ G+ CR Sbjct: 79 QGGGGRYQG---GGGRYQGGGGRYQGGGGRQGGGGSGGSYCR 117 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = -3 Query: 337 YEYHHHGHAEFGRQHVQYPMIQHWFGDHLLAHAVGLPRVLGHRNVNIID 191 +++HHH H + ++H + + Q H ++ + L H ++NI+D Sbjct: 359 HDHHHHHHQQQQQRHHAFNISQ---PTHPISTIISPSTSLHHASINILD 404 >At5g04140.2 68418.m00402 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1648 Score = 26.6 bits (56), Expect = 8.1 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 173 PIRPDLVNDVHVSMSKNSR----QPYCVSKEVVTKPVLNHGVLDVL 298 P+R LV + V++ K P S+ +++ PVLN G L+ L Sbjct: 644 PLREGLVMSLEVNIGKRGNILELGPENASQVILSNPVLNEGALEEL 689 >At5g04140.1 68418.m00401 glutamate synthase (GLU1) / ferredoxin-dependent glutamate synthase (Fd-GOGAT 1) identical to ferredoxin-dependent glutamate synthase precursor [Arabidopsis thaliana] GI:3869251 Length = 1622 Score = 26.6 bits (56), Expect = 8.1 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 173 PIRPDLVNDVHVSMSKNSR----QPYCVSKEVVTKPVLNHGVLDVL 298 P+R LV + V++ K P S+ +++ PVLN G L+ L Sbjct: 618 PLREGLVMSLEVNIGKRGNILELGPENASQVILSNPVLNEGALEEL 663 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,995,222 Number of Sequences: 28952 Number of extensions: 214471 Number of successful extensions: 691 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -