BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00567 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1104 + 27623632-27623795,27624052-27624175,27624316-276248... 28 9.2 >06_03_1104 + 27623632-27623795,27624052-27624175,27624316-27624832, 27624943-27625073,27625161-27625567,27625690-27625963, 27626195-27626814,27627424-27627859 Length = 890 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -3 Query: 490 DINSLLDVLVYRILSNGSVQVAHNRIFQVRMLHVTSDAHSQFSHEYDQEEY*KRYYH 320 D N L D+ + +LSNG AH I VR + A S S +E+ + +YH Sbjct: 614 DDNELADLEL--LLSNGESLKAHTAIISVRCPKLLPSAKSLGSDGKITDEWGRSFYH 668 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,880,988 Number of Sequences: 37544 Number of extensions: 413516 Number of successful extensions: 1126 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -