BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00565 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 4.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 6.5 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 734 SNFGPRQQSLNQTVPNILMVARKC--PHIENPF 642 SN+ P Q ++V + +V R+C P E P+ Sbjct: 214 SNYSPSQSPEPESVRPLSLVVRRCEEPTEEKPW 246 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +1 Query: 610 WRHLRPLLSCEKGFS 654 W H R L+ C++ F+ Sbjct: 343 WMHFRGLMDCDERFT 357 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,050 Number of Sequences: 336 Number of extensions: 4189 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -