BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00565 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 26 1.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 3.5 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 24 4.7 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/61 (21%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +1 Query: 199 DDRKHSQLVGYVRRKMSRFTSTILIELIHDDYTQDYYIRIL-----YRNSTEIIEPSILN 363 D +HS LV Y+ + + + ++ +HDD +++R++ YR +I+ ++ Sbjct: 213 DKLRHSPLVVYLMKAFRAHANALGMKQLHDD-VSGFFMRVVKDTVEYREREQIVRNDFMD 271 Query: 364 I 366 + Sbjct: 272 L 272 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -2 Query: 705 QSNSPKHFDGSSQVSTYRESFFT*QQWPKVTPYLLDYSLPRTHFRPGL 562 +S P H G V Y + F Q K PY D +L ++ R + Sbjct: 747 RSPQPHHGHGGIPVGHYAQHHFNSQGSRKAEPYYCDRTLVQSLVRDAI 794 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 34 WLQLQDGNGDTSIGPS*SWA 93 W+ L DG+G TS G WA Sbjct: 223 WVLLMDGDGRTSKGFKSEWA 242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 858,071 Number of Sequences: 2352 Number of extensions: 18828 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -