BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00562X (374 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0428 - 3379116-3379262,3379357-3379537,3379690-3379785,337... 28 2.7 07_03_1210 + 24903389-24903695,24904383-24904468,24904545-249046... 27 6.3 >05_01_0428 - 3379116-3379262,3379357-3379537,3379690-3379785, 3379886-3380034,3380120-3380392,3380895-3380983, 3381923-3382015,3382143-3382238,3382370-3382477, 3382917-3383208 Length = 507 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 313 QYNKITIYNIFK*KCL 266 QYN+I IYNI+ KCL Sbjct: 284 QYNQIDIYNIYAPKCL 299 >07_03_1210 + 24903389-24903695,24904383-24904468,24904545-24904649, 24904737-24905531,24905719-24905941,24906318-24906712 Length = 636 Score = 26.6 bits (56), Expect = 6.3 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 258 NMFLNALSTYL--KVLFSQLQLKNLIVVKNWYKNYFL 154 N+ ++L Y + FS QLKNL + K+W K++++ Sbjct: 494 NISADSLQIYFPGENFFSVCQLKNLRISKDWVKSHWV 530 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,739,352 Number of Sequences: 37544 Number of extensions: 120903 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 600754600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -