BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00560X (391 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 3.3 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 4.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 4.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 20 7.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 7.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 7.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 7.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 7.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 10.0 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 1.1 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 302 SLQTYSQAYFIYYTIIHCML 243 SL Y + +F + ++HC L Sbjct: 521 SLAHYLRVFFTVFNVVHCYL 540 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 3.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 321 IPSLWLVTPNLLTSLLYILYNHTLYVIITLGR 226 + + LV NLL LY+ H ++TL R Sbjct: 61 LSGIQLVVRNLLDISLYLNAYHVFVTMMTLKR 92 Score = 19.8 bits (39), Expect = 10.0 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 171 ILRDGPWML*NITILVEIQDRFFLFFFYPVSNIM 70 I+ G W+ +L++ + + LF VSN++ Sbjct: 137 IVEIGGWLAFTKQLLIKFVEVYPLFVLLIVSNVV 170 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 4.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 29 YIDDILVAGHT 61 YIDD+LVA T Sbjct: 457 YIDDLLVASET 467 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 4.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 281 LVSRFGVTSHXDG 319 +V +GV SH DG Sbjct: 216 IVGEYGVVSHDDG 228 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 5.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 71 WTPECDQLQVCRQ 33 W+P CD+L Q Sbjct: 236 WSPNCDKLSSTEQ 248 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 5.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 71 WTPECDQLQVCRQ 33 W+P CD+L Q Sbjct: 469 WSPNCDKLSSTEQ 481 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 5.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 71 WTPECDQLQVCRQ 33 W+P CD+L Q Sbjct: 469 WSPNCDKLSSTEQ 481 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 20.2 bits (40), Expect = 7.5 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -2 Query: 240 ITLGRTGHGVTVHSCLSSVHPEEILRDGPWML*NITILVEIQDRF 106 IT+ +G +C + P+ R PW+ + I+ D+F Sbjct: 486 ITVNNQSNGNRKGTCRIFLAPKTDERGNPWLFRDQKIMFIELDKF 530 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.5 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -3 Query: 71 WTPECDQL 48 WTP+C++L Sbjct: 482 WTPKCERL 489 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.5 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -3 Query: 71 WTPECDQL 48 WTP+C++L Sbjct: 482 WTPKCERL 489 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.5 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -3 Query: 71 WTPECDQL 48 WTP+C++L Sbjct: 482 WTPKCERL 489 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.5 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -3 Query: 71 WTPECDQL 48 WTP+C++L Sbjct: 482 WTPKCERL 489 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 19.8 bits (39), Expect = 10.0 Identities = 5/15 (33%), Positives = 10/15 (66%) Frame = -3 Query: 56 DQLQVCRQCIRIHYN 12 ++ Q C+ C R+ Y+ Sbjct: 793 NEKQCCKNCARVDYS 807 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,841 Number of Sequences: 336 Number of extensions: 2065 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8225022 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -