BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00559X (508 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.22 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 25 0.39 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 22 2.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 4.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 4.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 4.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 4.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.3 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.8 bits (54), Expect = 0.22 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = +3 Query: 204 LLTEAPLNPKANREKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPP 341 +++ PL P + T +K +T+P +KP P PP Sbjct: 155 VISSTPLPPTTSTTTRTTLTTKFTTKPSTKPTNKPVVVTKPPQAPP 200 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 25.0 bits (52), Expect = 0.39 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 117 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 212 +VT+W + E+I++ +L V PV+LT Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 86 PDPQIPHRTRNRH 124 PD +P RT NRH Sbjct: 110 PDNFLPERTANRH 122 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.8 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 155 MPNLLHVIPVSDDSVFD 105 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.8 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 155 MPNLLHVIPVSDDSVFD 105 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.8 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 155 MPNLLHVIPVSDDSVFD 105 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.8 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 155 MPNLLHVIPVSDDSVFD 105 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.3 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 8/44 (18%) Frame = -2 Query: 447 SSRPAKSRR----TMAW--GSA--YPS*MXTVWETPSPESSTIP 340 +++PA+S T +W GS YP T W P P +S P Sbjct: 1342 TAKPAQSTTSVSTTTSWNPGSTTNYPEWQPTEWHPPIPPTSEKP 1385 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,489 Number of Sequences: 336 Number of extensions: 2387 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -