BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00559X (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 25 0.60 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.8 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 9.7 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 24.6 bits (51), Expect = 0.60 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 371 SHTVXIYEGYALPHAIVRLDLAGRELTEYLMKI 469 +H + Y GY P + D A E TE MK+ Sbjct: 187 NHQLISYAGYKNPDGTIIGDPANIEFTELCMKL 219 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 174 LRVAPEEHPVLLTEAPLNPKANREKM 251 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 325 RVQREHGLDGDVHGG 281 RV ++G+ GD +GG Sbjct: 63 RVYDKNGMTGDAYGG 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,031 Number of Sequences: 438 Number of extensions: 2859 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -