BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00557 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39479| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_35074| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_16827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_39479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/66 (22%), Positives = 31/66 (46%) Frame = +3 Query: 9 KKCCYCFPLRIGCFILGYLTMFTNVYNTGLLITLTNYIGAGSHSFDRTTSFDSIDLEELS 188 K CC C +RIG +LG+ +F ++ +L + + + +T + ++ +S Sbjct: 18 KTCCCCMDVRIGTIVLGFCHLFIHIAGVVVLAQMLLHPEVYEEKYYQT--YGTVPRSAIS 75 Query: 189 EPTTTL 206 P T+ Sbjct: 76 NPNKTM 81 >SB_35074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 251 RIVLLMTIVINAAWLLVNIACVVGLHRRRPGNIKFYVLFAACRLVLVFAGL---VYLTMT 421 ++ L +TI+ WL + + +V HR ++ A+ L+L+ +G+ VY Sbjct: 234 KLCLTVTIIYATCWLPILVLYIVSFHRPELVAYGSFIYKASVALILLNSGINPFVYALQI 293 Query: 422 ITTP 433 + TP Sbjct: 294 LATP 297 >SB_702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 418 HCQVH*TSKDQDEAAGCEEDVELDVTRSPPV*SDHTSDVDKQPCSIYYYRHQKHDPT 248 HC+ S++++E+A +E+ ELD + TS + PC +H +H PT Sbjct: 1283 HCKTS-DSEERNESAESDEENELDRVQRLTSLRSFTSGQPESPCPECQIQHHRH-PT 1337 >SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 72 FTNVYNTGLLITLTNYIGAGSHSFDRTTSFDSIDLEELSEPT 197 F V +GLL+ +TN+ G G+ + ++ + SEPT Sbjct: 1491 FRTVKRSGLLLVITNHTGKGAVTLEQLEGQIVLSFTSESEPT 1532 >SB_16827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 266 MTIVINAAWLLVNIACVVGLHRRRPGNIK 352 ++ + N +W+LV +AC++ RR+P +K Sbjct: 24 ISAISNLSWILVGLACLLQEVRRKPQPLK 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,053,602 Number of Sequences: 59808 Number of extensions: 418683 Number of successful extensions: 984 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -