BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00552 (537 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22918| Best HMM Match : efhand (HMM E-Value=2.8e-09) 42 2e-04 SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) 29 3.2 SB_14987| Best HMM Match : TPR_2 (HMM E-Value=0.0065) 27 7.3 >SB_22918| Best HMM Match : efhand (HMM E-Value=2.8e-09) Length = 231 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 173 DISTHTGQKWDSDDYRLVRFTNAPKQV 253 D THTGQ WD DYR VRFTN K+V Sbjct: 112 DTVTHTGQVWDDADYRNVRFTNREKEV 138 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +1 Query: 244 KTSNPNWAVNLIAEIPPKEVTERVVWCDG 330 K NPN+++NL+AE PP ++ R V CDG Sbjct: 136 KEVNPNFSINLVAEEPPIKIKGRSVNCDG 164 >SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) Length = 2232 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 259 NWAVNLIAEIPPKEVTERVVWCDGGSGPEGHPRVYINLDK 378 NW ++ + KEV +VV+ GG GP+ H LDK Sbjct: 926 NWETDVSYGVA-KEVNRKVVFMFGGQGPQWHGMAKELLDK 964 >SB_14987| Best HMM Match : TPR_2 (HMM E-Value=0.0065) Length = 1171 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 341 GPLPPSHQTTLSVTSLGGISAIKFTAQFGLLVLA 240 GP L SLGG SA+K +FGLL A Sbjct: 475 GPNAAKQVAYLWAKSLGGDSAVKLLTKFGLLEAA 508 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,343,634 Number of Sequences: 59808 Number of extensions: 280250 Number of successful extensions: 581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -