BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00551 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.8 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 6.8 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 21 9.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.0 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 21 9.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.0 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 185 PLTILPSPQ*STCSISSPVKGSLSS 111 P+ +P PQ + +I SPV+ LSS Sbjct: 792 PVYCVPVPQVNDSTILSPVREKLSS 816 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 285 PVRDENDCDTRAYIKDDSVKIVTLMSAPIIPNSA-RDITRIVN 410 P+R +DC T + + D +V L +S R + IV+ Sbjct: 419 PIRKISDCSTTSSLSGDESDVVELQPVKSSKSSGWRKLRNIVH 461 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 177 RQRGTVFGLP*LLQRKPTVPRGQQRADKDRK 269 R + TV LP L R P+V KD+K Sbjct: 555 RLKSTVSLLPLPLARTPSVMSASSTCKKDKK 585 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 180 DDTPLTPVVDMLDQLSSE 127 D+TPL PVV + + S+E Sbjct: 439 DETPLDPVVVISNDKSTE 456 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 532 LTGTDNDGLARGFPQQATSY 591 LT D DG +GFP + + Y Sbjct: 17 LTTQDVDGFLQGFPGKNSPY 36 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/23 (30%), Positives = 8/23 (34%) Frame = -1 Query: 324 CKPGCRSRSRRAPGSCWGSCDPC 256 C P R P + C PC Sbjct: 56 CTPDAAELKRNLPDALENECSPC 78 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +3 Query: 564 WLSSTSNFLWICCSSTCRPGTTTRQ 638 W T + CS C PG +Q Sbjct: 437 WARGTKDIPISACSLPCEPGMIKKQ 461 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/23 (30%), Positives = 8/23 (34%) Frame = -1 Query: 324 CKPGCRSRSRRAPGSCWGSCDPC 256 C P R P + C PC Sbjct: 56 CTPDAAELKRNLPDALENECSPC 78 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +3 Query: 564 WLSSTSNFLWICCSSTCRPGTTTRQ 638 W T + CS C PG +Q Sbjct: 527 WARGTKDIPISACSLPCEPGMIKKQ 551 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,011 Number of Sequences: 438 Number of extensions: 3982 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -