BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00549 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 26 5.2 SPBC646.15c |||Pex16 family protein|Schizosaccharomyces pombe|ch... 26 6.9 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 26.2 bits (55), Expect = 5.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -3 Query: 698 TSSSSINDKLNNLSTPNTNFPSVYSTIDL 612 +SS S+ + ++LSTP+T P+ S++ L Sbjct: 525 SSSLSLTNAKSSLSTPSTTIPTSNSSVSL 553 >SPBC646.15c |||Pex16 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 376 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 258 INSNEDIINRLPRAFTARDKLENKCRGLS*IVPGYIFISHLGS*RIV*N 404 + +++ ++ RL ++ D L+N+ LS I+P IF L + RI N Sbjct: 173 LKNSKKVVPRLNTVNSSLDFLQNRTPRLSSILPDEIFTKRLPNLRIFSN 221 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,900,320 Number of Sequences: 5004 Number of extensions: 58412 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -