BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00547 (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 27 2.3 SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 4.0 SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su... 26 4.0 SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter |Schizo... 26 5.2 SPBC16A3.05c |rae1||RNA export factor Rae1|Schizosaccharomyces p... 26 5.2 SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomy... 26 5.2 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 25 6.9 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 628 SDRHSAYRQTGNTSSTYPYVVSGRD-LDAIFG 536 SDR S+Y N +ST P +VS L AI G Sbjct: 60 SDRASSYANANNVNSTQPQLVSSEQALLAILG 91 >SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 462 Score = 26.2 bits (55), Expect = 4.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 413 SPVYRAGVDKDIVGAPDADRGRRTESALRSGWYPQ 517 SP+ + +K++ AP ++ RRT S L +G YP+ Sbjct: 344 SPLDHSSAEKEMQKAPAKNKRRRTGS-LETGLYPK 377 >SPAP27G11.15 |slx1||structure-specific endonuclease catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 26.2 bits (55), Expect = 4.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 25 GRPLVLRCLVYGYP 66 GRP + CLVYG+P Sbjct: 52 GRPWSISCLVYGFP 65 >SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 572 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 612 RIVRRETLVPLIHMLSPDAILTPSLDQYTFSGCGYHPLRR 493 +I RR TL+ LI L ++ GC HPL R Sbjct: 184 KIKRRGTLISLIFAFQGFGTLAGAIVTIILLGCFEHPLNR 223 >SPBC16A3.05c |rae1||RNA export factor Rae1|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.8 bits (54), Expect = 5.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 524 NVYWSKDGVKIASG 565 +V WS+DG K+ASG Sbjct: 79 SVNWSRDGTKVASG 92 >SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 573 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -3 Query: 612 RIVRRETLVPLIHMLSPDAILTPSLDQYTFSGCGYHPLRRADSVRR 475 ++ RR TL+ LI L ++ GC HPL R R+ Sbjct: 184 KLNRRGTLISLIFAFQGFGTLAGAIVTIILLGCFEHPLNREGHYRK 229 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.4 bits (53), Expect = 6.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 338 RRVHYPHVDPLAGP 297 +RVH+ VDPL GP Sbjct: 856 KRVHWQRVDPLPGP 869 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,514,350 Number of Sequences: 5004 Number of extensions: 48656 Number of successful extensions: 157 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -