BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00547 (635 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain... 33 0.21 At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain... 33 0.21 At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain... 33 0.21 At1g44760.1 68414.m05128 universal stress protein (USP) family p... 29 3.4 At2g02680.1 68415.m00207 DC1 domain-containing protein contains ... 28 6.0 At1g42460.1 68414.m04896 Ulp1 protease family protein contains P... 28 6.0 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 28 6.0 At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearl... 27 7.9 >At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 132 RSQRKRSSNKTTDRRGARGIRVSSIQRRRKPGHVTDGGSGVKQDDTPSDNK 284 R R +++ D G+RG SS + R GH + GSG + DD D + Sbjct: 226 RDDDYRGRSRSVDNYGSRGR--SSEREREDDGHSSSRGSGARADDNSQDGR 274 >At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 132 RSQRKRSSNKTTDRRGARGIRVSSIQRRRKPGHVTDGGSGVKQDDTPSDNK 284 R R +++ D G+RG SS + R GH + GSG + DD D + Sbjct: 226 RDDDYRGRSRSVDNYGSRGR--SSEREREDDGHSSSRGSGARADDNSQDGR 274 >At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 132 RSQRKRSSNKTTDRRGARGIRVSSIQRRRKPGHVTDGGSGVKQDDTPSDNK 284 R R +++ D G+RG SS + R GH + GSG + DD D + Sbjct: 226 RDDDYRGRSRSVDNYGSRGR--SSEREREDDGHSSSRGSGARADDNSQDGR 274 >At1g44760.1 68414.m05128 universal stress protein (USP) family protein contains Pfam profile PF00582: universal stress protein family Length = 213 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 609 IVRRETLVPLIHMLSPDAILTPSLDQYTFSGC 514 + + LV L+H++SPD TPSL Q S C Sbjct: 86 LTNKGDLVTLLHVVSPDDEATPSLAQSLGSLC 117 >At2g02680.1 68415.m00207 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 649 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 109 VPYSSTLYEARENVLLIRQLIDEALGEYACQAYNG 213 + ++S+L + + + + RQ +D G Y C A NG Sbjct: 290 ISFTSSLLKGKWSCGVCRQEVDRKYGAYTCNACNG 324 >At1g42460.1 68414.m04896 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 762 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 61 YPTPEIFWYRGLNGPMVPYSSTLYEARENVLLIRQLID 174 YP + RG G +PY STL+ E+V + R +D Sbjct: 104 YPKVQKKKKRGTGGKQMPYYSTLFGLEEDVTVERAHLD 141 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 150 NVFSGFVQCTAVWHHGTVKSSVPEDF 73 NV S VQ AVW G+V SS PE F Sbjct: 375 NVVSHPVQRFAVWFGGSVLSSTPEFF 400 >At1g70320.1 68414.m08090 ubiquitin-protein ligase 2 (UPL2) nearly identical to ubiquitin-protein ligase 2 [Arabidopsis thaliana] GI:7108523; E3, HECT-domain protein family; similar to ubiquitin-protein ligase 2 GI:7108523 from [Arabidopsis thaliana] Length = 3658 Score = 27.5 bits (58), Expect = 7.9 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = +1 Query: 73 EIFWYRGLNGP-----MVPYSSTLYEARENVLLIRQLIDEALGEYACQAYNGEGSPATLL 237 EI G NGP +PYS L +LL L +LG YA N GS +LL Sbjct: 462 EIVCCSGSNGPEDDTEQLPYSEALISYHRRLLLKALLRAISLGTYAPGNTNLYGSEESLL 521 Query: 238 ME 243 E Sbjct: 522 PE 523 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,644,376 Number of Sequences: 28952 Number of extensions: 275294 Number of successful extensions: 934 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 934 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -