BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00543 (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.14 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 2.2 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 3.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 27.1 bits (57), Expect = 0.14 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -2 Query: 473 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLKTLC-LCTH 297 + L FS ++ + F +++ F SE + +++ YFR + KT C L T Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKTFCTLVTA 412 Query: 296 SSFCGI 279 +C + Sbjct: 413 LVYCSL 418 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 157 ILDHLTDVLSGVGVCDLI 104 IL H+ SG+ +CDLI Sbjct: 252 ILWHIVGTFSGIFLCDLI 269 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 519 PPSLIAAGLSLVAKHLR 469 PP GLSL A HL+ Sbjct: 41 PPKRAPVGLSLAASHLQ 57 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = -1 Query: 153 LIILRMFCLELVFAISLISFGSNHTFFLPHRITEAASLFC 34 L I +C ++F + L+ + FF I LFC Sbjct: 144 LCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFC 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,741 Number of Sequences: 336 Number of extensions: 3382 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -