BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00539 (603 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04290.1 68414.m00420 thioesterase family protein contains Pf... 62 3e-10 At2g29590.1 68415.m03593 thioesterase family protein contains Pf... 44 8e-05 At3g16175.1 68416.m02042 thioesterase family protein contains Pf... 44 1e-04 At5g26710.1 68418.m03168 glutamate-tRNA ligase, putative / gluta... 28 4.1 At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase... 27 7.2 At5g09790.1 68418.m01133 PHD finger family protein / SET domain-... 27 9.6 >At1g04290.1 68414.m00420 thioesterase family protein contains Pfam profile PF03061: thioesterase family protein; EST gb|T45093 comes from this gene Length = 155 Score = 62.1 bits (144), Expect = 3e-10 Identities = 30/78 (38%), Positives = 48/78 (61%) Frame = +2 Query: 257 AHLVDAISTYALTTNENVDTRGVSIDLSLSFYSAAKEGDNIEVEAKTRKTGKKIAFLEVE 436 A LVD I + + T GVS+++++S+ AA + IE+E+K + GK +A + VE Sbjct: 72 ATLVDLIGSAVIYT-AGASHSGVSVEINVSYLDAAFLDEEIEIESKALRVGKAVAVVSVE 130 Query: 437 VRNKDKNQVLASGRHTKY 490 +R K +++A GRHTKY Sbjct: 131 LRKKTTGKIIAQGRHTKY 148 >At2g29590.1 68415.m03593 thioesterase family protein contains Pfam profile PF03061: thioesterase family protein Length = 158 Score = 44.0 bits (99), Expect = 8e-05 Identities = 26/79 (32%), Positives = 44/79 (55%) Frame = +2 Query: 254 LAHLVDAISTYALTTNENVDTRGVSIDLSLSFYSAAKEGDNIEVEAKTRKTGKKIAFLEV 433 +A+LVD + AL E + VS+D+S++F S AK G+ +E+ ++ V Sbjct: 75 IANLVDEVGG-ALVHGEGLPM-SVSVDMSIAFLSKAKLGEELEITSRLLGERGGYKGTIV 132 Query: 434 EVRNKDKNQVLASGRHTKY 490 VRNK +++A GRH+ + Sbjct: 133 VVRNKMTGEIIAEGRHSMF 151 >At3g16175.1 68416.m02042 thioesterase family protein contains Pfam profile PF03061: thioesterase family protein Length = 157 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/52 (32%), Positives = 33/52 (63%) Frame = +2 Query: 323 VSIDLSLSFYSAAKEGDNIEVEAKTRKTGKKIAFLEVEVRNKDKNQVLASGR 478 +S+DL+ SFYS AK + +E+EA+ + + +E+R + +++A+GR Sbjct: 86 ISVDLNSSFYSTAKIHETVEIEARVNGSNGGLKSAVIEIRRETSGEIIATGR 137 >At5g26710.1 68418.m03168 glutamate-tRNA ligase, putative / glutamyl-tRNA synthetase, putatuve / GluRS, putative identical to gi:3435196 Length = 719 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 218 TLKSKRHTTWWILAHLVDAISTYALTTNENVDTRGVSIDLSLSF 349 TL SKR W++ LVD T + + RG+ I+ + F Sbjct: 447 TLLSKRKLLWFVQTGLVDGWDDPRFPTVQGIVRRGLKIEALIQF 490 >At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase (MAPKK), putative (MKK9) mitogen-activated protein kinase kinase (MAPKK) family, PMID:12119167 Length = 310 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 111 TKTIAATKGFDQ-NLRKLKVTSCGNGSMV 194 T T+A G +L KL V CGNG +V Sbjct: 33 TTTVAGCNGISACDLEKLNVLGCGNGGIV 61 >At5g09790.1 68418.m01133 PHD finger family protein / SET domain-containing protein contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain Length = 352 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 264 KCARIHHVVCLFDLSVQVPLGT 199 KC R H+ CL + V+VP+GT Sbjct: 84 KCDRGFHMKCLRPIVVRVPIGT 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,940,969 Number of Sequences: 28952 Number of extensions: 201791 Number of successful extensions: 512 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -