BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00538 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 244 VRFGTFCN*IVMSCKPMFGRMKSWRLVALLEGRSNGNPI 360 +R C+ V+ CKP G W+ + + S G+PI Sbjct: 34 LRIHKICDDYVIECKPRAGSNDQWKFIRITHMDSGGHPI 72 >SB_41245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 550 CGCGWPQHMLVPKGLKPACPSNCSLC 473 C C W Q+M +P G P CS C Sbjct: 101 CLCLWVQYMCLPMGAVPVFVYGCSTC 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,974,791 Number of Sequences: 59808 Number of extensions: 474549 Number of successful extensions: 959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -