BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00531 (636 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 26 0.30 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 26 0.30 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 2.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 2.8 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.9 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 8.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.8 bits (54), Expect = 0.30 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 462 PHNHD*ILFTNKQANQHPCTRRGKKG*RAQHSNQL 566 P N D L N+ ++ P +++ KKG + H N L Sbjct: 427 PTNFD-ALIVNEMRSEKPESKKDKKGSQVDHKNNL 460 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.8 bits (54), Expect = 0.30 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 462 PHNHD*ILFTNKQANQHPCTRRGKKG*RAQHSNQL 566 P N D L N+ ++ P +++ KKG + H N L Sbjct: 319 PTNFD-ALIVNEMRSEKPESKKDKKGSQVDHKNNL 352 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 463 LTITTKSYSQTNKQTNTPALVEVRRANVLNTL 558 + TK S N+++N P + + RRA + N+L Sbjct: 24 MAAATKRVSD-NRRSNKPIMEKRRRARINNSL 54 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 156 IFIVIPHTLINKLWFHFGSDS 94 IFI+IP TL + +F G +S Sbjct: 501 IFIIIPVTLTSVCYFMIGLNS 521 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 57 VFCRTRGTCFQWIYAFS 7 VFCR R + + YAFS Sbjct: 112 VFCRDRVNPYLFYYAFS 128 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 223 GSATGDVNISGV 258 GS GDVNIS + Sbjct: 33 GSVLGDVNISAI 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,578 Number of Sequences: 336 Number of extensions: 3521 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -