BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00530X (401 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 24 0.64 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 24 0.64 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 24 0.64 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 3.4 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 6.0 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 20 7.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 20 7.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 7.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 7.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 7.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 7.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 7.9 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 23.8 bits (49), Expect = 0.64 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -2 Query: 367 AINSNYSNLDVVGTAALAANVPTPYKFELTFTLSRTLKT 251 A N+ N G+ L P PYK + F L+ T Sbjct: 299 AFIDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGT 337 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 23.8 bits (49), Expect = 0.64 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -2 Query: 367 AINSNYSNLDVVGTAALAANVPTPYKFELTFTLSRTLKT 251 A N+ N G+ L P PYK + F L+ T Sbjct: 300 AFIDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGT 338 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 23.8 bits (49), Expect = 0.64 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -2 Query: 367 AINSNYSNLDVVGTAALAANVPTPYKFELTFTLSRTLKT 251 A N+ N G+ L P PYK + F L+ T Sbjct: 300 AFIDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGT 338 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 3.4 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 350 LKFGCSWNSGPS 315 L+ C+W+SGP+ Sbjct: 14 LQLECNWSSGPN 25 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 20.6 bits (41), Expect = 6.0 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 320 GRCSNYIQI 346 GRC++YIQ+ Sbjct: 67 GRCASYIQV 75 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 139 REHLGLVT*NYF 174 REHLGL NY+ Sbjct: 23 REHLGLKHDNYY 34 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 139 REHLGLVT*NYF 174 REHLGL NY+ Sbjct: 337 REHLGLKHDNYY 348 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 307 VPTPYKFELTFTLSRTLKTFTKL 239 +PTPY L +TL K L Sbjct: 664 IPTPYGGRLVWTLPGKTKMIAHL 686 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 307 VPTPYKFELTFTLSRTLKTFTKL 239 +PTPY L +TL K L Sbjct: 664 IPTPYGGRLVWTLPGKTKMIAHL 686 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 139 REHLGLVT*NYF 174 REHLGL NY+ Sbjct: 570 REHLGLKHDNYY 581 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 139 REHLGLVT*NYF 174 REHLGL NY+ Sbjct: 570 REHLGLKHDNYY 581 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 307 VPTPYKFELTFTLSRTLKTFTKL 239 +PTPY L +TL K L Sbjct: 664 IPTPYGGRLVWTLPGKTKMIAHL 686 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 307 VPTPYKFELTFTLSRTLKTFTKL 239 +PTPY L +TL K L Sbjct: 664 IPTPYGGRLVWTLPGKTKMIAHL 686 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,512 Number of Sequences: 336 Number of extensions: 1631 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8646818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -