BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00530X (401 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 25 1.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 4.2 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 25.0 bits (52), Expect = 1.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -2 Query: 292 KFELTFTLSRTLKTFTKLTVYCMFTLKLFLSGL 194 KF + T SR K KL + MFT K LSG+ Sbjct: 402 KFRID-TTSRAEKPLAKLGLITMFTSKADLSGI 433 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 4.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 154 DQDVLDAPTTRRNH 113 D D+ D PT R NH Sbjct: 1616 DVDIADVPTNRLNH 1629 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,640 Number of Sequences: 2352 Number of extensions: 8182 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32067225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -