BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00530X (401 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z34802-4|CAA84335.4| 365|Caenorhabditis elegans Hypothetical pr... 27 5.0 Z68301-2|CAA92625.1| 366|Caenorhabditis elegans Hypothetical pr... 26 8.8 >Z34802-4|CAA84335.4| 365|Caenorhabditis elegans Hypothetical protein M88.4 protein. Length = 365 Score = 27.1 bits (57), Expect = 5.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 214 KLFLSGLYVHRGTENNSKSLDQDVL 140 +LFLSGL V R N+ S++Q+ L Sbjct: 158 RLFLSGLLVPRNNNNSEGSVNQNAL 182 >Z68301-2|CAA92625.1| 366|Caenorhabditis elegans Hypothetical protein W01B6.2 protein. Length = 366 Score = 26.2 bits (55), Expect = 8.8 Identities = 14/65 (21%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -2 Query: 253 TFTKLTVYCMFTLKLFLSGLYVHRGTENNSKSLDQDVLDAPTTRRNHVI-FFYRRKLSVL 77 T++++ + C++ LK ++HR + + L + D+ R H++ F R +V Sbjct: 127 TWSRIGIQCLYALKYVHDNGFIHRDVKPQNFLLGNET-DSERARIVHILDFGLARPFAVF 185 Query: 76 ESRRS 62 +R + Sbjct: 186 HAREN 190 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,669,655 Number of Sequences: 27780 Number of extensions: 158146 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -