BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00527 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 29 0.10 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 26 0.95 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 24 3.8 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 24 3.8 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 24 3.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.9 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 29.5 bits (63), Expect = 0.10 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 276 RCHLRLFLSQSQRHNLRNLHYFHRYRVSVNYSSLPVHF-LNVSFHYTIQEY 425 RC L+ ++ L N H R + N SL HF N SF T++ Y Sbjct: 69 RCIFELWAHSNE--GLANFHQALRQHIETNAQSLATHFEANKSFKITVETY 117 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 26.2 bits (55), Expect = 0.95 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 611 LDRSDNDPKGRSKIDDYYNFTNAS 540 LD +DN+P ++DYY NAS Sbjct: 1051 LDENDNNPYFVDSVNDYYVSENAS 1074 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 358 HRHRVGANYLMLPVN 372 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 342 HRYRVSVNYSSLPVH 386 HR+RV NY LPV+ Sbjct: 342 HRHRVGANYLMLPVN 356 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.9 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 204 NVCVQIETAKIRLYF*MSNTILFYIKHLNYFFRLTSPNNVLYWN 73 N V + + L + +SN + H + FF LT+PN W+ Sbjct: 31 NNTVFVRKNRALLIYQLSNKDYTEVFHEDDFFSLTTPNANYPWH 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,180 Number of Sequences: 2352 Number of extensions: 12730 Number of successful extensions: 41 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -