BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00523 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0725 + 19749227-19749361,19749705-19749772,19749869-197499... 28 6.8 01_06_0928 + 33085403-33089224 28 6.8 >09_04_0725 + 19749227-19749361,19749705-19749772,19749869-19749938, 19750244-19751482,19755359-19755423,19755502-19755655, 19755725-19755733 Length = 579 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 343 IMGCNYHQSTDIIAGYSLPAGPSQ*P-DSSGSLELQ*VSMSVHIVGGLPKMTIQGSFLFL 519 ++G NYH+ + Y+LPA S SS +L L+ +++ V + +M + F L Sbjct: 10 LLGLNYHELQSLCKQYNLPANKSHSQLASSLALFLEVAKVAIKEVRKVKEMMVIDLFCML 69 Query: 520 L 522 L Sbjct: 70 L 70 >01_06_0928 + 33085403-33089224 Length = 1273 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 501 RVIFISTYLTSCLHFMIAENNQMVTLNIIK 590 RV+++S Y T+ L IAE N + LNIIK Sbjct: 561 RVLYLSFYNTTNLPESIAELNHLRYLNIIK 590 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,440,640 Number of Sequences: 37544 Number of extensions: 235331 Number of successful extensions: 308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -