BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00523 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69884-10|CAA93753.1| 400|Caenorhabditis elegans Hypothetical p... 29 2.7 Z69883-7|CAA93745.1| 400|Caenorhabditis elegans Hypothetical pr... 29 2.7 AF047658-4|AAC04417.1| 392|Caenorhabditis elegans Hypothetical ... 28 6.1 AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ... 27 8.1 >Z69884-10|CAA93753.1| 400|Caenorhabditis elegans Hypothetical protein C27C12.3 protein. Length = 400 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 584 NV*CNHLIIFCDHKMKTGC*ISRNKNDPCMVILGKPPTIW 465 NV NH ++ + IS NKN +++ G P TIW Sbjct: 213 NVRSNHRVLEVARETMNSSDISPNKNTSSVLLDGSPSTIW 252 >Z69883-7|CAA93745.1| 400|Caenorhabditis elegans Hypothetical protein C27C12.3 protein. Length = 400 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 584 NV*CNHLIIFCDHKMKTGC*ISRNKNDPCMVILGKPPTIW 465 NV NH ++ + IS NKN +++ G P TIW Sbjct: 213 NVRSNHRVLEVARETMNSSDISPNKNTSSVLLDGSPSTIW 252 >AF047658-4|AAC04417.1| 392|Caenorhabditis elegans Hypothetical protein K03H6.1 protein. Length = 392 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 336 CYYNGMQLSSVYRHHCWI*P 395 CYY+GM+ YR+ W+ P Sbjct: 195 CYYSGMRHQKTYRNKDWVTP 214 >AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical protein Y40C5A.3 protein. Length = 2344 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -2 Query: 524 ISRNKNDPCMVILGKPPT---IWTDILTY*SSREP 429 IS++ DP MVI KPPT IW +S EP Sbjct: 12 ISKSFGDPPMVITAKPPTSPNIWLGSNDLKTSNEP 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,693,127 Number of Sequences: 27780 Number of extensions: 242187 Number of successful extensions: 410 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -