BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00521 (563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.53 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.53 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.53 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.8 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 3.7 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 3.7 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 3.7 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 22 4.9 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 6.5 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 6.5 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 8.6 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 8.6 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 8.6 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 25.0 bits (52), Expect = 0.53 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -2 Query: 532 KSIIHSSRSVPYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 +S+ +S +VP L G+Y ++F +V L +V + HHR Sbjct: 245 ESMPTTSDAVP--LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 25.0 bits (52), Expect = 0.53 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -2 Query: 532 KSIIHSSRSVPYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 +S+ +S +VP L G+Y ++F +V L +V + HHR Sbjct: 245 ESMPTTSDAVP--LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 25.0 bits (52), Expect = 0.53 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -2 Query: 532 KSIIHSSRSVPYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 +S+ +S +VP L G+Y ++F +V L +V + HHR Sbjct: 245 ESMPTTSDAVP--LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 493 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 493 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 493 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 L G+Y ++F +V L +V + HHR Sbjct: 256 LLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 2.8 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -2 Query: 532 KSIIHSSRSVPYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 +S+ +S +VP L G+Y ++F +V L +V HHR Sbjct: 313 ESMPTTSDAVP--LIGSYFNCIMFMVASSVVLTVLVLNFHHR 352 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 3.7 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = -3 Query: 315 TASLTFFFLCLIFLGVE*FFSCVS*RH 235 ++S++F+ C++ LG+ C + +H Sbjct: 196 SSSISFYVPCIVMLGIYCRLYCYAQKH 222 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 335 DENGKIHRLXRECTGD 382 DE +I RL R C+GD Sbjct: 48 DEYDEIGRLKRTCSGD 63 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 335 DENGKIHRLXRECTGD 382 DE +I RL R C+GD Sbjct: 48 DEYDEIGRLKRTCSGD 63 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 216 GGGWIPSGYCSPRGYVHLPA 157 GG P GY +G+VHL A Sbjct: 77 GGLEEPKGYTLFKGFVHLGA 96 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 504 TLRLLCMMDFK*NLDTV 554 TLR+LCM D K + T+ Sbjct: 162 TLRVLCMTDGKEGMHTL 178 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 493 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 L G+Y ++F +V L +V HHR Sbjct: 324 LLGSYFNCIMFMVASSVVLTVLVLNFHHR 352 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 8.6 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -2 Query: 541 FYLKSIIHSSRSVPYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 407 F L S I S S+ L G YL + +V + V+ +H+R Sbjct: 281 FLLISEIIPSTSLALPLLGKYLLFTMILVGLSVVITIVILNVHYR 325 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +2 Query: 350 IHRLXRECTGDXYGAGVFMAVMEDRHYCGKCHSTMVFKDDD 472 +H + D VF V ED+ C H T + DD Sbjct: 18 LHAIFVNAAPDWVPPEVFDLVAEDKARCMSEHGTTQAQIDD 58 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +2 Query: 350 IHRLXRECTGDXYGAGVFMAVMEDRHYCGKCHSTMVFKDDD 472 +H + D VF V ED+ C H T + DD Sbjct: 18 LHAIFVNAAPDWVPPEVFDLVAEDKARCMSEHGTTQAQIDD 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,979 Number of Sequences: 438 Number of extensions: 3014 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -