BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00519 (491 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.1 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.0 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 8.0 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 6.1 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 251 SLSAGHQAVLH 283 SLS+ HQA+LH Sbjct: 338 SLSSDHQAMLH 348 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 20.6 bits (41), Expect = 8.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 201 RLSPRSLVGANVMELHLHFLQVIRQYCTQGFAIV 302 RLS + VM HFL + Y + F I+ Sbjct: 4 RLSRNDIRFLKVMYKLSHFLSITPNYDFENFVII 37 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = -1 Query: 197 LQQVSECKYDEGWQHNAHRTNQ 132 L + +C Y EGW + +Q Sbjct: 219 LPKQEDCFYQEGWNGQSFDVSQ 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,210 Number of Sequences: 336 Number of extensions: 1960 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -