BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00518 (607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 4.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 6.1 DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 21 8.1 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 21 8.1 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 348 KTLPCKERSAYDVDY*GSEKSHDP 277 K L ++ + + Y +EKSHDP Sbjct: 248 KVLEVLQKMSVEEMYLAAEKSHDP 271 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +1 Query: 337 WEGFDPNRGTSARLQRIGNNGGKHCSFSPVVLREFNG 447 W GFD + +++ I +NG + + +F+G Sbjct: 400 WIGFDDEKSIRNKMKWIKDNGFAGAMVWTIDMDDFSG 436 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 417 EAAMLPAIIPDAL 379 EAA+L +IPDAL Sbjct: 56 EAAILRDVIPDAL 68 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 417 EAAMLPAIIPDAL 379 EAA+L +IPDAL Sbjct: 56 EAAILRDVIPDAL 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,347 Number of Sequences: 336 Number of extensions: 2458 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -