BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00518 (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35740.2 68417.m05073 DNA helicase (RECQl3) identical to DNA ... 31 0.45 At4g35740.1 68417.m05072 DNA helicase (RECQl3) identical to DNA ... 31 0.45 At5g50110.1 68418.m06205 methyltransferase-related contains weak... 30 1.0 At5g57500.1 68418.m07185 expressed protein 29 2.4 At3g52260.2 68416.m05743 pseudouridine synthase family protein s... 28 5.5 At3g52260.1 68416.m05744 pseudouridine synthase family protein s... 28 5.5 >At4g35740.2 68417.m05073 DNA helicase (RECQl3) identical to DNA Helicase [Arabidopsis thaliana] GI:11121447; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 620 Score = 31.5 bits (68), Expect = 0.45 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 4/81 (4%) Frame = -3 Query: 395 LFPMR*SRAEVPRLGSKPSHAKNAPPTMLTIRAVKNPMILKSQ----*LLTDIQYKLTLD 228 L +R S A+VP L + A ++ ++NP++LKS + +++YK LD Sbjct: 89 LSTLRDSLADVPVLALTATAAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFYEVRYKDLLD 148 Query: 227 NLYLFIDQQFLDNSGAQCSVL 165 N Y + L + G C+++ Sbjct: 149 NAYTDLG-NLLKSCGNICAII 168 >At4g35740.1 68417.m05072 DNA helicase (RECQl3) identical to DNA Helicase [Arabidopsis thaliana] GI:11121447; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 713 Score = 31.5 bits (68), Expect = 0.45 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 4/81 (4%) Frame = -3 Query: 395 LFPMR*SRAEVPRLGSKPSHAKNAPPTMLTIRAVKNPMILKSQ----*LLTDIQYKLTLD 228 L +R S A+VP L + A ++ ++NP++LKS + +++YK LD Sbjct: 182 LSTLRDSLADVPVLALTATAAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFYEVRYKDLLD 241 Query: 227 NLYLFIDQQFLDNSGAQCSVL 165 N Y + L + G C+++ Sbjct: 242 NAYTDLG-NLLKSCGNICAII 261 >At5g50110.1 68418.m06205 methyltransferase-related contains weak similarity to Methyltransferase gidB (EC 2.1.-.-) (Glucose inhibited division protein B). (Swiss-Prot:Q93D95) [Streptococcus mutans] Length = 208 Score = 30.3 bits (65), Expect = 1.0 Identities = 22/78 (28%), Positives = 34/78 (43%) Frame = +1 Query: 259 RSYCDLRIMGFFTALIVNIVGGAFFAWEGFDPNRGTSARLQRIGNNGGKHCSFSPVVLRE 438 R+ ++R++ + +V I GG F A +G DP + GG SPV Sbjct: 118 RAVAEMRVLAEYCLPLVRI-GGLFVAAKGHDPKEEVQNAENAVRLLGGSILQISPVDSHS 176 Query: 439 FNGRKHYIKVDCRRHDST 492 G++ V CR+ ST Sbjct: 177 PYGQR--TTVVCRKDHST 192 >At5g57500.1 68418.m07185 expressed protein Length = 318 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 113 KFDSQFVFVKLTKLFQEVTLSTELQSYREIV 205 K D +FVF LTK Q+V ++ E+ Y +I+ Sbjct: 102 KVDVKFVFCNLTKEDQKVLVALEIMRYDDII 132 >At3g52260.2 68416.m05743 pseudouridine synthase family protein similar to SP|P39219 Ribosomal large subunit pseudouridine synthase A (EC 4.2.1.70) (Pseudouridylate synthase) (Uracil hydrolyase) {Escherichia coli}; contains Pfam profile PF00849: RNA pseudouridylate synthase Length = 369 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 526 QQLSVFTNLWSWCYHGGGSQL*YNASGH*IPVIRLG 419 QQ +V T L WC+ S + S H +PV RLG Sbjct: 124 QQRTVLTQL-QWCFGKNDSYIGSRESPHPVPVHRLG 158 >At3g52260.1 68416.m05744 pseudouridine synthase family protein similar to SP|P39219 Ribosomal large subunit pseudouridine synthase A (EC 4.2.1.70) (Pseudouridylate synthase) (Uracil hydrolyase) {Escherichia coli}; contains Pfam profile PF00849: RNA pseudouridylate synthase Length = 294 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 526 QQLSVFTNLWSWCYHGGGSQL*YNASGH*IPVIRLG 419 QQ +V T L WC+ S + S H +PV RLG Sbjct: 124 QQRTVLTQL-QWCFGKNDSYIGSRESPHPVPVHRLG 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,107,072 Number of Sequences: 28952 Number of extensions: 216426 Number of successful extensions: 401 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -