BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00516 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27530.2 68415.m03331 60S ribosomal protein L10A (RPL10aB) 111 3e-25 At2g27530.1 68415.m03330 60S ribosomal protein L10A (RPL10aB) 111 3e-25 At1g08360.1 68414.m00925 60S ribosomal protein L10A (RPL10aA) si... 110 1e-24 At5g22440.1 68418.m02617 60S ribosomal protein L10A (RPL10aC) 105 3e-23 At3g58660.1 68416.m06538 60S ribosomal protein-related contains ... 40 0.001 At2g42650.1 68415.m05278 60S ribosomal protein-related similar t... 40 0.002 At1g06380.1 68414.m00674 ribosomal protein-related similar to PB... 36 0.026 At1g08400.1 68414.m00929 chromosome structural maintenance prote... 30 1.3 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 30 1.7 At5g14210.1 68418.m01660 leucine-rich repeat transmembrane prote... 30 1.7 At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta... 29 2.2 At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta... 29 2.2 At5g10610.1 68418.m01228 cytochrome P450 family protein similar ... 29 3.9 At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01... 28 6.8 >At2g27530.2 68415.m03331 60S ribosomal protein L10A (RPL10aB) Length = 216 Score = 111 bits (268), Expect = 3e-25 Identities = 48/78 (61%), Positives = 64/78 (82%) Frame = +1 Query: 19 SKVSRDTLYECVNAVLQSSKDKKRNFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPRPK 198 SK+ + + E + + S++KKRNF+ETVELQIGLKNYDPQKDKRFSG+VKL +IPRPK Sbjct: 2 SKLQSEAVREAITTIKGKSEEKKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPK 61 Query: 199 MQVCVLGDQQHCDEAKTL 252 M++C+LGD QH +EA+ + Sbjct: 62 MKICMLGDAQHVEEAEKM 79 Score = 91.5 bits (217), Expect = 5e-19 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 348 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKVLCL 506 SES+IKQIPRLLGPGLNKAGKFP L+SHQES+ K++E K T+KFQ+KKVLC+ Sbjct: 112 SESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCM 164 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +2 Query: 509 VAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPQRLY 661 VAVG++ M +L QNV +S+NFLVSLLKK+WQNVR L++KSTMGPPQR++ Sbjct: 166 VAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216 >At2g27530.1 68415.m03330 60S ribosomal protein L10A (RPL10aB) Length = 216 Score = 111 bits (268), Expect = 3e-25 Identities = 48/78 (61%), Positives = 64/78 (82%) Frame = +1 Query: 19 SKVSRDTLYECVNAVLQSSKDKKRNFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPRPK 198 SK+ + + E + + S++KKRNF+ETVELQIGLKNYDPQKDKRFSG+VKL +IPRPK Sbjct: 2 SKLQSEAVREAITTIKGKSEEKKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPK 61 Query: 199 MQVCVLGDQQHCDEAKTL 252 M++C+LGD QH +EA+ + Sbjct: 62 MKICMLGDAQHVEEAEKM 79 Score = 91.5 bits (217), Expect = 5e-19 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 348 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKVLCL 506 SES+IKQIPRLLGPGLNKAGKFP L+SHQES+ K++E K T+KFQ+KKVLC+ Sbjct: 112 SESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCM 164 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +2 Query: 509 VAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPQRLY 661 VAVG++ M +L QNV +S+NFLVSLLKK+WQNVR L++KSTMGPPQR++ Sbjct: 166 VAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216 >At1g08360.1 68414.m00925 60S ribosomal protein L10A (RPL10aA) similar to 60S ribosomal protein L10A GB:AAC73045 GI:3860277 from [Arabidopsis thaliana] Length = 216 Score = 110 bits (264), Expect = 1e-24 Identities = 47/78 (60%), Positives = 63/78 (80%) Frame = +1 Query: 19 SKVSRDTLYECVNAVLQSSKDKKRNFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPRPK 198 SK+ + + E + + S+ KKRNF+ET+ELQIGLKNYDPQKDKRFSG+VKL +IPRPK Sbjct: 2 SKLQSEAVREAITTITGKSEAKKRNFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPK 61 Query: 199 MQVCVLGDQQHCDEAKTL 252 M++C+LGD QH +EA+ + Sbjct: 62 MKICMLGDAQHVEEAEKM 79 Score = 91.9 bits (218), Expect = 4e-19 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 348 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKVLCL 506 SES+IKQIPRLLGPGLNKAGKFP L+SHQES+ K++E K T+KFQ+KKVLC+ Sbjct: 112 SESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCM 164 Score = 77.8 bits (183), Expect = 6e-15 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +2 Query: 509 VAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPQRLY 661 VAVG++ M ++ QNV +S+NFLVSLLKK+WQNVR L++KSTMGPPQR++ Sbjct: 166 VAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216 >At5g22440.1 68418.m02617 60S ribosomal protein L10A (RPL10aC) Length = 217 Score = 105 bits (252), Expect = 3e-23 Identities = 45/79 (56%), Positives = 64/79 (81%), Gaps = 1/79 (1%) Frame = +1 Query: 19 SKVSRDTLYECVNAVLQSSKDKK-RNFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPRP 195 SK+ + + E +++++ K+ K RNF ET+ELQIGLKNYDPQKDKRFSG+VKL ++PRP Sbjct: 2 SKLQSEAVREAISSIITHCKETKPRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHVPRP 61 Query: 196 KMQVCVLGDQQHCDEAKTL 252 KM++C+LGD QH +EA+ + Sbjct: 62 KMKICMLGDAQHVEEAEKI 80 Score = 91.9 bits (218), Expect = 4e-19 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 348 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKVLCL 506 SES+IKQIPRLLGPGLNKAGKFP L+SHQES+ K++E K T+KFQ+KKVLC+ Sbjct: 113 SESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCM 165 Score = 75.4 bits (177), Expect = 3e-14 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = +2 Query: 509 VAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPQRLY 661 VAVG++ M ++ QNV +S+NFLVSLLKK+WQNVR L++KSTMGPP R++ Sbjct: 167 VAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPNRVF 217 >At3g58660.1 68416.m06538 60S ribosomal protein-related contains weak similarity to 60S ribosomal protein L10A (CSA-19) (NEDD-6) (Swiss-Prot:P53026) [Mus musculus] Length = 446 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +2 Query: 494 GVVSFVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMK 631 G S + VG + M E+ +NV ++N LV L W VRSLH+K Sbjct: 204 GTCSVIKVGKLSMDICEITENVMATLNGLVEFLPNKWTYVRSLHLK 249 >At2g42650.1 68415.m05278 60S ribosomal protein-related similar to PBK1 protein (GI:3668141) [Homo sapiens]; weak similarity to 60S ribosomal protein L10a. (Swiss-Prot:Q9SW75) [Chlamydomonas reinhardtii] Length = 372 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +2 Query: 494 GVVSFVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMK 631 G S + V + M D++ +NV ++N +V +L W+ +RSLH+K Sbjct: 184 GSCSAIKVAKLSMESDDIVENVTATLNGVVDVLPSRWKYIRSLHLK 229 >At1g06380.1 68414.m00674 ribosomal protein-related similar to PBK1 protein (GI:3668141) {Homo sapiens}; weakly similar to 60S ribosomal protein L10a. (SP:Q963B6) [Fall armyworm] {Spodoptera frugiperda} Length = 254 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 494 GVVSFVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMK 631 G S V V + M +E+A+NV ++N + L+ W+NV+ H+K Sbjct: 195 GTCSVVKVAKLSMGRNEIAENVVAAMNGIGDLVPGRWKNVKLFHLK 240 >At1g08400.1 68414.m00929 chromosome structural maintenance protein-related contains weak similarity to RAD50-interacting protein 1 [Homo sapiens] gi|11967435|gb|AAG42101 Length = 804 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +1 Query: 16 SSKVSRDTLYECVNAVLQSSKDKKRNFLETVELQIGLKNYDPQKDKR 156 +SKV + N +L DKK ++ ++ L GL+ ++ QK+KR Sbjct: 232 TSKVEHGEVDSIPNPLLLMQGDKKESYSQSFLLLCGLQQHNTQKEKR 278 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 545 LAQNVHLSINFLVSLLKKH 601 + + VHLS+NF++ L+KKH Sbjct: 322 IVEGVHLSLNFVMGLMKKH 340 >At5g14210.1 68418.m01660 leucine-rich repeat transmembrane protein kinase, putative Length = 812 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 583 HKEVDGKMHILSKLIRSHVHMANCYERH 500 H E+ GK+ LSKL SH+HM + E H Sbjct: 222 HNEISGKLPDLSKL--SHLHMLDLRENH 247 >At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 698 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 545 LAQNVHLSINFLVSLLKKH 601 + + VHLS+NF++ L+KKH Sbjct: 279 VVEGVHLSLNFVMGLMKKH 297 >At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 717 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 545 LAQNVHLSINFLVSLLKKH 601 + + VHLS+NF++ L+KKH Sbjct: 298 VVEGVHLSLNFVMGLMKKH 316 >At5g10610.1 68418.m01228 cytochrome P450 family protein similar to Cytochrome P450 91A1 (SP:Q9FG65) [Arabidopsis thaliana]; similar to cytochrome P450, Helianthus tuberosus, EMBL:HTCYP81L Length = 500 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 97 LETVELQIGLKNYDPQKDKRFSGTVKLKNIPRPKMQVC 210 L V + G+K DP+ +KRF KL+ M VC Sbjct: 185 LRLVSGKRGVKKSDPESEKRFLDDFKLRFFSSMSMNVC 222 >At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; contains TIGRFAM TIGR00864: polycystin cation channel protein; similar to fimbriae-associated protein Fap1 [Streptococcus parasanguinis] (GI:3929312) Length = 1498 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = -2 Query: 187 VCFLALQCRRNACPSVGHSSSDQFEALQSPKSYVSCP*RIEERHSRTRRACHETL*TTFC 8 + + A+ + HS + EALQS S V +++ SR R H TT Sbjct: 867 ISYKAVMAEERSARKAMHSKRQEIEALQSMISRVKSAASVDDIDSRVRNMEHTMQHTTLS 926 Query: 7 LS 2 L+ Sbjct: 927 LN 928 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,641,790 Number of Sequences: 28952 Number of extensions: 333362 Number of successful extensions: 852 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -