BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00514 (794 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2||... 27 3.1 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 27 3.1 SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 27 3.1 SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1||... 26 7.1 SPAC14C4.14 |atp1||F1-ATPase alpha subunit|Schizosaccharomyces p... 25 9.4 >SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 85 DYDTNEDLLYAYSPIPYFGMYHLVKIPIDRGLVHHVDYWG 204 ++ T ++ + A+ P+ Y G + L +P D+ +H+ D G Sbjct: 311 EFGTWDNGIKAFIPMEYVGTHLLDGVPPDKSCIHNYDNAG 350 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 27.1 bits (57), Expect = 3.1 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +1 Query: 277 SSVRATTRESKYPTGSPSCLWT--TATLPVTSETTASKLLPSARGRSLSGALQTSPGLST 450 +S TT S PTG S L T T T+P TS ++ S +P S P ST Sbjct: 168 TSTSCTTSTSIPPTGGSSSLSTPITPTVPPTSTSSTSIPIPPTSTSSTDTNSSPLPTTST 227 Score = 26.2 bits (55), Expect = 5.4 Identities = 26/89 (29%), Positives = 37/89 (41%), Gaps = 4/89 (4%) Frame = +1 Query: 262 TNS--LRSSVRATTRESKYPTGSPSCLWT--TATLPVTSETTASKLLPSARGRSLSGALQ 429 TNS L ++ + T + PTG S L T T T+P TS ++ S +P S Sbjct: 217 TNSSPLPTTSTSCTTSTSIPTGGSSSLSTPITPTVPPTSTSSTSIPIPPTSTSSTDTNSS 276 Query: 430 TSPGLSTRPKLVVAYGYSENSDDIQNPSV 516 P ST + + NS P+V Sbjct: 277 PLPTTSTSCTTSTSIPPTGNSTTPVTPTV 305 >SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 673 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 85 DYDTNEDLLYAYSPIPYFGMYHLVKIPIDRGLVHHVDYWG 204 ++ T ++ + A+ P+ Y G + L +P D+ +H+ D G Sbjct: 311 EFGTWDNGIKAFIPMEYVGTHLLDGVPPDKSCIHNYDNAG 350 >SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.8 bits (54), Expect = 7.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 173 LSIGIFTRWYIPK*GIGEYAYNR 105 LSI F +WY+ I E+ Y R Sbjct: 13 LSISFFLQWYLANTWIAEFLYRR 35 >SPAC14C4.14 |atp1||F1-ATPase alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 25.4 bits (53), Expect = 9.4 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = +1 Query: 436 PGLSTRPKLVVAYGYSENSDDIQNPSVSWQKRLILWSR---VRTARRLEDPDGIQHEDGL 606 P RP + + GY+E + + PS+ ++ +++ + + R L DGI GL Sbjct: 13 PVCGLRPSITLKRGYAEKAAPTEVPSILEERIRGAYNQAQMMESGRVLSIGDGIARISGL 72 Query: 607 CRRNVNQQPLVXLGYG 654 NV + LV G Sbjct: 73 --SNVQAEELVEFSSG 86 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,918,406 Number of Sequences: 5004 Number of extensions: 57411 Number of successful extensions: 132 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -