BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00514 (794 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1608|AAN10688.1| 118|Drosophila melanogaster CG31887-P... 30 3.2 AE014298-1753|AAF48147.2| 1860|Drosophila melanogaster CG2750-PA... 29 9.7 >AE014134-1608|AAN10688.1| 118|Drosophila melanogaster CG31887-PA protein. Length = 118 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 310 YPTGSPSCLWTTATLPVTSETTASKLLPSA 399 +PT P CLW A L VT+ +A L +A Sbjct: 71 WPTNGPRCLWANAFLSVTNYDSAEVLFLAA 100 >AE014298-1753|AAF48147.2| 1860|Drosophila melanogaster CG2750-PA protein. Length = 1860 Score = 28.7 bits (61), Expect = 9.7 Identities = 19/73 (26%), Positives = 30/73 (41%) Frame = +1 Query: 268 SLRSSVRATTRESKYPTGSPSCLWTTATLPVTSETTASKLLPSARGRSLSGALQTSPGLS 447 S S T E+ PT S + +T +P T T S P+ RG + + +PG Sbjct: 1779 SQNSVANETQPETPQPTRSINRSRSTRRVPSTPRTPRSPSTPNVRGDTSPNSSTRTPGQQ 1838 Query: 448 TRPKLVVAYGYSE 486 + +Y Y + Sbjct: 1839 PCDMVSTSYPYGK 1851 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,806,544 Number of Sequences: 53049 Number of extensions: 671579 Number of successful extensions: 1684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1683 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3695805360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -