BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00511 (763 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy... 26 6.7 SPBC1709.18 |tif452|SPBC409.01|translation initiation factor eIF... 25 8.9 SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pom... 25 8.9 SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|ch... 25 8.9 >SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1010 Score = 25.8 bits (54), Expect = 6.7 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 482 LVRNLNYKRRNINGRHLNNDAIAC-CSFSQLSVFNKLNAQFINI 610 +V N N+KR++I H + + AC +FS V ++L+ F++I Sbjct: 361 MVVNANHKRQSIQVNHFDITSDACMLNFSH--VLSRLSEPFLDI 402 >SPBC1709.18 |tif452|SPBC409.01|translation initiation factor eIF4E 4F complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 236 QSAHDGKNIKKVYLFIYLFTTRRTNSPLGQ 325 QS H G N+ +++L++ L T P G+ Sbjct: 144 QSKHKGSNLDELWLYMVLAAIGETLDPTGK 173 >SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 25.4 bits (53), Expect = 8.9 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 368 RDLYWLFVSIICYIIV 321 R LYW+FV++ C ++ Sbjct: 135 RILYWIFVAVACIFVI 150 >SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 614 VFKHSHCIFLSFYSRDCFYSIVIFHRLLFFEYILLLMFV 730 VF+H HC L Y + +++ LLF ++L ++FV Sbjct: 6 VFEHVHCSVL--YKFNNIVKFDLYNVLLFLLFLLPVLFV 42 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,798,167 Number of Sequences: 5004 Number of extensions: 53045 Number of successful extensions: 144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -