BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00511 (763 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC071597-1|AAH71597.1| 450|Homo sapiens KIAA0286 protein protein. 31 4.5 AB006624-1|BAA22955.2| 446|Homo sapiens KIAA0286 protein. 31 4.5 U07807-1|AAA20232.1| 62|Homo sapiens metallothionein IV protein. 30 7.8 BC113444-1|AAI13445.1| 62|Homo sapiens metallothionein 4 protein. 30 7.8 BC113442-1|AAI13443.1| 62|Homo sapiens metallothionein 4 protein. 30 7.8 >BC071597-1|AAH71597.1| 450|Homo sapiens KIAA0286 protein protein. Length = 450 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 584 KLNAQFINIIVFKHSHCIFLSFYSRDCFYSIVIFHRL---LFFEYILLLM 724 KLN ++N+ ++ C+ + +D YS+++ R LF ++L LM Sbjct: 129 KLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLM 178 >AB006624-1|BAA22955.2| 446|Homo sapiens KIAA0286 protein. Length = 446 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 584 KLNAQFINIIVFKHSHCIFLSFYSRDCFYSIVIFHRL---LFFEYILLLM 724 KLN ++N+ ++ C+ + +D YS+++ R LF ++L LM Sbjct: 125 KLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLM 174 >U07807-1|AAA20232.1| 62|Homo sapiens metallothionein IV protein. Length = 62 Score = 30.3 bits (65), Expect = 7.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 193 CVTCHCSSCGTIC*PICP 246 C TC+C +C C P CP Sbjct: 22 CTTCNCKTCRKSCCPCCP 39 >BC113444-1|AAI13445.1| 62|Homo sapiens metallothionein 4 protein. Length = 62 Score = 30.3 bits (65), Expect = 7.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 193 CVTCHCSSCGTIC*PICP 246 C TC+C +C C P CP Sbjct: 22 CTTCNCKTCRKSCCPCCP 39 >BC113442-1|AAI13443.1| 62|Homo sapiens metallothionein 4 protein. Length = 62 Score = 30.3 bits (65), Expect = 7.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 193 CVTCHCSSCGTIC*PICP 246 C TC+C +C C P CP Sbjct: 22 CTTCNCKTCRKSCCPCCP 39 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,884,260 Number of Sequences: 237096 Number of extensions: 1794048 Number of successful extensions: 7363 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7357 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -