BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00511 (763 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g10836.1 68415.m01153 hypothetical protein 28 5.9 At1g61710.1 68414.m06960 DC1 domain-containing protein contains ... 28 5.9 >At2g10836.1 68415.m01153 hypothetical protein Length = 282 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -1 Query: 640 KNAMGMLKYYNINKLCIKFIEDTQLTK----TTTCYSVII*MTSVDISTFIIQIS 488 K+A+G + NKL IKF++ T+L+ Y V++ + ++ F+ Q+S Sbjct: 112 KSAVGRKRPLTDNKLRIKFLQTTKLSPVDRLVPNAYGVVVRVENITRPDFVPQVS 166 >At1g61710.1 68414.m06960 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 402 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 608 IIVFKHSHCIFLSFYSRDCFYSIVIFHRLLFFEY 709 I + +H+H I +F R C +S +FH+++ +Y Sbjct: 163 IKISRHNHRISYTFSLRSCEWSCGVFHQIIDGDY 196 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,960,642 Number of Sequences: 28952 Number of extensions: 257713 Number of successful extensions: 585 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -