BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00509 (715 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) 29 4.9 SB_35622| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_21784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) 29 4.9 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 470 TEFLKAELSGLQTEILAEVFSVVNIHRRGKLG 565 T FL +SGL ++ + F VV HR+ +LG Sbjct: 162 THFLSGAISGLFAALITQPFDVVKTHRQIELG 193 >SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) Length = 1136 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 514 IGRGIFCCKHPPKRE 558 IG+G+FC K PPK E Sbjct: 412 IGKGLFCTKKPPKAE 426 >SB_35622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 514 IGRGIFCCKHPPKRE 558 IG+G+FC K PPK E Sbjct: 267 IGKGLFCTKKPPKAE 281 >SB_21784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 514 IGRGIFCCKHPPKRE 558 IG+G+FC K PPK E Sbjct: 67 IGKGLFCTKKPPKAE 81 >SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) Length = 1487 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 514 IGRGIFCCKHPPKRE 558 IG+G+FC K PPK E Sbjct: 388 IGKGLFCTKKPPKAE 402 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 88 HLLSTYFIRQIGTRLRDSNTGALLHTNAPDVLSFRSRRLRI 210 HL + ++ GTRL S TGA++H + SF RLR+ Sbjct: 139 HLCNDDLQKETGTRLY-SLTGAVIHIQPLNFSSFSVERLRV 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,834,776 Number of Sequences: 59808 Number of extensions: 424837 Number of successful extensions: 935 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -