BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00509 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 27 0.77 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.1 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 7.2 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 9.5 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 26.6 bits (56), Expect = 0.77 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = -3 Query: 296 VPRIQHNPLRLLEYTLPKSV*RAEYTVGYIRSRRDLKDKTSGAFVCNNAPVFESRRRVPI 117 + +Q N +L + K + T G ++ R ++D + AFV A S + Sbjct: 258 INNVQRNDFMMLLMKMLKEQMEQDGTAGDLKDRITIEDVAAQAFVFFLAGFETSSTAMSF 317 Query: 116 CLMKYVLNR 90 CL + LN+ Sbjct: 318 CLYELALNQ 326 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 238 TLFGRVYSSNLKGLCWIRGTSK 303 TL ++ S+L CW+RG++K Sbjct: 1375 TLMPKIQFSSLIVSCWLRGSNK 1396 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 238 TLFGRVYSSNLKGLCWIRGTSK 303 TL ++ S+L CW+RG++K Sbjct: 1376 TLMPKIQFSSLIVSCWLRGSNK 1397 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = +2 Query: 398 VRLQLSLLHSNRLNKFFVMIFYTRTEFLKAELSGLQTEILAE 523 V L+ L NR+ IFY L +LS + T E Sbjct: 17 VNLEYLFLSHNRITTLPAEIFYPLRSLLHLDLSNMDTRRTGE 58 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 133 RDSNTGALLHTNAPDVLSFRSRRLR 207 R+ T L+ N PD+L + R+ R Sbjct: 1090 REIITDILIRANRPDILVYEKRKKR 1114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,048 Number of Sequences: 2352 Number of extensions: 13963 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -