Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00509
         (715 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL...    27   9.3  

>At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1
            (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1
            (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta)
            {Arabidopsis thaliana}; contains Pfam profiles: PF00614
            phospholipase D.active site motif, PF00168 C2 domain
          Length = 1083

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +1

Query: 112  RQIGTRLRDSNTGALLHTNAPDVLSFRSRRLRIY 213
            R++   + +S TG+  + N P  LS +SRR  +Y
Sbjct: 899  REMVDGIDNSGTGSPSNANTPQALSRKSRRFMVY 932


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,444,794
Number of Sequences: 28952
Number of extensions: 292148
Number of successful extensions: 662
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 635
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 662
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)