BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00508 (528 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 3e-32 SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 31 0.59 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 28 5.5 SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 28 5.5 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 27 7.2 SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 134 bits (325), Expect = 3e-32 Identities = 59/78 (75%), Positives = 73/78 (93%) Frame = +1 Query: 28 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 207 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IKGVGRRY+NIV KKADID++KRAGE T Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELT 60 Query: 208 EEEVEKIITIMSNPRHIR 261 E+EVE+++TIM NPR + Sbjct: 61 EDEVERVVTIMQNPRQYK 78 Score = 116 bits (278), Expect = 2e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +3 Query: 255 YKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAHRGMRHYWGLRVRGQH 431 YKIPDWFLNRQKD DGKYSQ+ ++ LD+K+REDLERLKKIRAHRG+RHYWGLRVRGQH Sbjct: 77 YKIPDWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAHRGLRHYWGLRVRGQH 135 >SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = +1 Query: 28 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIK 129 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IK Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIK 34 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 31.1 bits (67), Expect = 0.59 Identities = 25/89 (28%), Positives = 43/89 (48%) Frame = +1 Query: 34 LVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECTEE 213 + + D+F+H+ ++N ++ K+ + + +G+ ++I LK A + K T E Sbjct: 1073 VTMADRFEHLDTLLNLSMIHKKHSVQVAKYLFDIGKMTADIGLKMAAAEGLKLPKAKTPE 1132 Query: 214 EVEKIITIMSNPRHIRYQTGS*IGKRILL 300 E KI M RHI IG+ ILL Sbjct: 1133 EKRKIQYAMHIGRHIMR-----IGREILL 1156 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 258 KIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAH 386 K PD LN KD +GK T+ + ++L D ++ K R+H Sbjct: 661 KHPDPSLNVNKDSEEGKTQAQTTDEIIAQLISDHKKKKNARSH 703 >SB_58448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/48 (25%), Positives = 27/48 (56%) Frame = +1 Query: 124 IKGVGRRYSNIVLKKADIDLDKRAGECTEEEVEKIITIMSNPRHIRYQ 267 ++G+GR I + + ++ +++ EE+ ++ TI+ NP H +Q Sbjct: 508 VRGMGRTKGYIDMLQEEMKREQQEVTMASEEMARVNTILCNPGHRGHQ 555 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 258 KIPDWFLNRQKDIVDGKYSQLTSSNLD-SKLREDLERLKKIRAHRGMR 398 K+ W L+ V+ KY + S + + + LRE+LE +KK+R G++ Sbjct: 2757 KLHQWLLD-----VENKYKEKASDSANVAVLREELEDIKKLRQDMGIQ 2799 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 27.9 bits (59), Expect = 5.5 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = -2 Query: 218 TSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIAN 108 T +++HS + ++++ F+ + +E RPT L ++ N Sbjct: 826 TDTALHSKGKDNKTLDLFVSSRVEKYRPTKLHEIVGN 862 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 49 KFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECTEEEVEKI 228 +F+H ++ + KRK + + +NI K DIDL G CTE+E+ ++ Sbjct: 59 EFRHEVQASTRKVSSKRKPIRKRRTVT------ANISATKYDIDL---LGYCTEQEIRRV 109 Query: 229 I 231 + Sbjct: 110 V 110 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 276 LNRQKDIVDGKYSQLTSSNLDSKLREDLERLK 371 L R+K + + KY + +N D K RE++E LK Sbjct: 873 LRREKKVFE-KYQKAARANPDKKEREEIESLK 903 >SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = +3 Query: 315 QLTSS--NLDSKLREDLERLKKI 377 QLTS N+D K+RE LE++KK+ Sbjct: 72 QLTSEEDNVDPKIREGLEKIKKL 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,019,684 Number of Sequences: 59808 Number of extensions: 307850 Number of successful extensions: 823 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -