BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00504 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 28 7.7 AC006809-4|AAO25980.1| 339|Caenorhabditis elegans Activated in ... 28 7.7 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 112 NKEYHNYTMIWKPNGIEVLVDGEQFGVVDPGEGFYTVGRQNA 237 +K YH+ T IW N + + G + V +GFY QNA Sbjct: 275 DKMYHHRTEIWYNNDMSI---GSSYHVCQEADGFY-CSNQNA 312 >AC006809-4|AAO25980.1| 339|Caenorhabditis elegans Activated in blocked unfolded proteinresponse protein 4 protein. Length = 339 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 225 PAECSTSCGPWLKGTIMAPLDQIFYISLGLRV 320 P +C SC P K + +AP QI ISL L V Sbjct: 125 PVQCQPSCMPACKQSCVAPAPQI--ISLNLEV 154 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,324,201 Number of Sequences: 27780 Number of extensions: 313480 Number of successful extensions: 863 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -