SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00503
         (334 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    24   0.48 
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    21   4.5  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 23.8 bits (49), Expect = 0.48
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 7/58 (12%)
 Frame = +2

Query: 68   SNS*MFKVSDCNAF------VSSVRKQVVNIPSFIVRLD-SGKHIDFSLKSPFGGGRP 220
            S+S +F     NAF      ++ + ++V  +P  +  LD SG+ +  S  +PF G  P
Sbjct: 868  SDSALFTCVATNAFGSDDTSINMIVQEVPEVPYGLKVLDKSGRSVQLSWVAPFDGNSP 925


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 20.6 bits (41), Expect = 4.5
 Identities = 4/11 (36%), Positives = 9/11 (81%)
 Frame = +1

Query: 115 QCPQASCEHPI 147
           +CP+ +C+ P+
Sbjct: 88  ECPEPTCDEPV 98


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,816
Number of Sequences: 336
Number of extensions: 1166
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 49
effective length of database: 106,121
effective search space used:  6473381
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -